DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or22b

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:400 Identity:71/400 - (17%)
Similarity:139/400 - (34%) Gaps:106/400 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HRYPWRSICCILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLW--LYKDFK 91
            |...|.:...:|   .|:.|.|:..::.:|..:..:..      :.|:..:||:.::  .:|.:.
  Fly    47 HYKLWSTFVTLL---IFILLPISVSVEYIQRFKTFSAG------EFLSSIQIGVNMYGSSFKSYL 102

  Fly    92 FLIGQFY----------------CVLQTETHTAVAEMIVTRESRRDQFISAMY--AY-CFITAGL 137
            .::|  |                ||...|      ..||.|......|....|  || .|:.:..
  Fly   103 TMMG--YKKRQEAKMSLDELDKRCVCDEE------RTIVHRHVALGNFCYIFYHIAYTSFLISNF 159

  Fly   138 SACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLSNY--IISYFWNVCAALGVALPTVCVDT 200
            .:.:|..:.....|           ||.|.|.....:|:.  :|...|.|...|       |.|.
  Fly   160 LSFIMKRIHAWRMY-----------FPYVDPEKQFYISSIAEVILRGWAVFMDL-------CTDV 206

  Fly   201 LFCSLSHNLCALFQIA--RHKMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFRPLICQF 263
              |.|...:.|...|.  :.::.:......:...|.||.:    |.|:.....:.:|...|...|
  Fly   207 --CPLISMVIARCHITLLKQRLRNLRSEPGRTEDEYLKEL----ADCVRDHRLILDYVDALRSVF 265

  Fly   264 VAASLHLCVLCYQLSANILQPALLFYAA---------FTAAVVGQVSIYCFCGSSIHSECQLFGQ 319
             :.::.:..|...:...:....::|::.         |.:.|..|...:|:..:.|..:||....
  Fly   266 -SGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEMAD 329

  Fly   320 AIYESSWP--------------HLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEANRETLITIVR 370
            ::::|.|.              |.||:.:.|.:                |..|..:.:|.:.:|:
  Fly   330 SLFQSDWTSADRRYKSTLVYFLHNLQQPIILTA----------------GGVFPISMQTNLNMVK 378

  Fly   371 TAISYVTLLR 380
            .|.:.||:::
  Fly   379 LAFTVVTIVK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 61/360 (17%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 61/354 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.