DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or22a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:216 Identity:44/216 - (20%)
Similarity:80/216 - (37%) Gaps:60/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 VCVDTLFCSLSHNLCALFQIA--RHKMMHFE---GRNTKETHENLKHVFQLYALCLNLGHFLNEY 255
            :|.|.  |.|...|.|...|:  :.::.:..   ||...|..|.|....:.:.|.|:....|...
  Fly   202 LCTDV--CPLISMLMARCHISLLKQRLRNLRSKPGRTEDEYLEELTECIRDHRLLLDYVDALRPV 264

  Fly   256 FR-PLICQF--VAASLHLCVLCYQLSANILQPALLFYAAF-----TAAVVGQVSI----YCFCGS 308
            |. .:..||  :...|.|.::           .|:|::.|     |...:..||:    :|:..:
  Fly   265 FSGTIFVQFLLIGTVLGLSMI-----------NLMFFSTFWTGVATCLFMFDVSMETFPFCYLCN 318

  Fly   309 SIHSECQLFGQAIYESSWP--------------HLLQENLQLVSSLKIAMMRSSLGCPIDGYFFE 359
            .|..:||.....:::|.|.              |.||:.:.|.:                |..|.
  Fly   319 MIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTA----------------GGVFP 367

  Fly   360 ANRETLITIVRTAISYVTLLR 380
            .:.:|.:.:|:.|.|.||:::
  Fly   368 ISMQTNLAMVKLAFSVVTVIK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 40/206 (19%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 40/207 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.