DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or10a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:401 Identity:84/401 - (20%)
Similarity:157/401 - (39%) Gaps:80/401 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GHRYPWRSIC--CILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLWLYKDF 90
            |..:||||:.  .||::.....|.......:.|.:....::||......:.|.|:.|.|...:|.
  Fly    37 GDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDL 101

  Fly    91 KFLIGQFYCVLQTETHTAVAEMIVTRESRRDQFI--SAMYA---YCFITAGLSACL---MSP--L 145
            ..:..:...:|.....        .|..:||..:  |||.|   :..::||...|.   :.|  :
  Fly   102 SIMWNRLRGLLFDPNW--------ERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILI 158

  Fly   146 SMLISYQRTGE----------LQPK----FP-FPSVYPWDNMKLSNYIISYFWNVCAALGVALPT 195
            :|::..|...|          ..||    :| ||..|.:  :..:.|:..:.:..|         
  Fly   159 AMILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIF--IAYTGYVTIFMFGGC--------- 212

  Fly   196 VCVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQLYAL-------------CLN 247
               |..:.....:|.|||::.:.::.......|  .|..|..| |||.|             .::
  Fly   213 ---DGFYFEFCAHLSALFEVLQAEIESMFRPYT--DHLELSPV-QLYILEQKMRSVIIRHNAIID 271

  Fly   248 LGHFLNEYFRPL-ICQFVAASLHLCVLCYQLSANILQ-----PALLFYAAFTAAVVGQVSIYCFC 306
            |..|..:.:..: :..||:|::   |:.:.: .|:|.     ...:.|.|:|.|.:.|:.:||:.
  Fly   272 LTRFFRDRYTIITLAHFVSAAM---VIGFSM-VNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYG 332

  Fly   307 GSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRS-SLGCPIDGYFFEANRETLITIVR 370
            |:.:........:|::...|.....:..:||..|.:...|. |:..|    ||..:..|...|::
  Fly   333 GTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVP----FFSPSLATFAAILQ 393

  Fly   371 TAISYVTLLRS 381
            |:.|.:.|::|
  Fly   394 TSGSIIALVKS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 71/357 (20%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 72/358 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.