DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or2a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:409 Identity:79/409 - (19%)
Similarity:154/409 - (37%) Gaps:92/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YPWR---------------------SICCILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDL 74
            |.||                     ||...|.|....||::...|....|:..|.::|...:.|:
  Fly    17 YHWRVWELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLTITITDI 81

  Fly    75 LALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRR-----DQFISAM------- 127
            :|..|   |..:|            :::.:.| .:..::...::|.     .:.|||:       
  Fly    82 VANLK---FANVY------------MVRKQLH-EIRSLLRLMDARARLVGDPEEISALRKEVNIA 130

  Fly   128 ------YAYCFITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNM-KLSNYIISYFWNV 185
                  :|..|:.....:|    :.:::...|      :..:|:.:..|.| ...||::...:.:
  Fly   131 QGTFRTFASIFVFGTTLSC----VRVVVRPDR------ELLYPAWFGVDWMHSTRNYVLINIYQL 185

  Fly   186 CAALGVALPTVCVDT----LFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLK-HVFQLYALC 245
            ...:..|:.....|:    ..|.|:.::.||....|......|..|..:|:|..: .|:|....|
  Fly   186 FGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIEC 250

  Fly   246 L-NLG--HFLNEYFR-----PLICQFVAASLHLCVLCYQ---LSANILQPALLFYAAFTAAVVGQ 299
            : :|.  |.|.|..:     |.:.|||.::...|.:...   ::.:....|::....|.:||..:
  Fly   251 IRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLE 315

  Fly   300 VSIYCFCGSSIHSECQLFGQAIYESSW----PHLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEA 360
            |.:.|:.|..:.::.:....|.|:.:|    |...:|.|..::..:    |.||  ...|.:...
  Fly   316 VFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQ----RPSL--IYAGNYIAL 374

  Fly   361 NRETLITIVRTAISYVTLL 379
            :.||...::|...|..|||
  Fly   375 SLETFEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 65/351 (19%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 65/352 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.