DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or98b and Or69a

DIOPT Version :9

Sequence 1:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:378 Identity:72/378 - (19%)
Similarity:135/378 - (35%) Gaps:96/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQT 103
            :.||||.:..||                     |..|.|.|:   |.|...|:.|:.:|..:.|.
  Fly    77 LASVASMLGFTI---------------------VGTLNLWKM---LSLKTHFENLLNEFEELFQL 117

  Fly   104 ETHTAVA----EMIVTRESRRDQFISAMYAYCFITAGLSACLMSPLSMLI--SYQRTGELQPKFP 162
            ..|.|..    :...||..|.        .:.|.|:.:......|:.::|  .:..:.:|..:..
  Fly   118 IKHRAYRIHHYQEKYTRHIRN--------TFIFHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQ 174

  Fly   163 FPSVYPWDNMKLSNYIISYFWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEG-- 225
            ..:.|||   ::...|..:|..|...:......:||: :|.....|...: |:.    :||:|  
  Fly   175 SNTWYPW---QVQGSIPGFFAAVACQIFSCQTNMCVN-MFIQFLINFFGI-QLE----IHFDGLA 230

  Fly   226 --------RNTKETHENLKHVFQLYALCLNLGHFLNEYFR-PLICQFVAASLHLCVLCYQLS--- 278
                    || ....:.||::...:...|||...:|..|. ..:.....:.:..|.|.:.::   
  Fly   231 RQLETIDARN-PHAKDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFD 294

  Fly   279 -----ANILQPALLFYAAFTAAVVGQVSIYCFCGSSIH---SECQLFGQAIYESSWPHLLQENLQ 335
                 .::|  .||.:..:.         :..|.|..|   :..::...|.| ::|   .:.:|.
  Fly   295 FGTSLKHLL--GLLLFITYN---------FSMCRSGTHLILTSGKVLPAAFY-NNW---YEGDLV 344

  Fly   336 LVSSLKIAMMRSSLGCPIDGYFFEANR------ETLITIVRTAISYVTLLRSL 382
            ....|.|.|||::     ..|.::..:      .|.:..::.:....|.:|||
  Fly   345 YRRMLLILMMRAT-----KPYMWKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 62/346 (18%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 68/367 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.