DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and CPR1

DIOPT Version :10

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_010439.1 Gene:CPR1 / 851733 SGDID:S000002562 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:98/167 - (58%)
Similarity:121/167 - (72%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQ 80
            :||:...|..:||:||:|:||:.||||||||||||||||||        |.|..||||:.|||:|
Yeast     5 YFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG--------YAGSPFHRVIPDFMLQ 61

  Fly    81 AGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVV 145
            .|||:|||||||:|||||.|.||:|:|.||||.||||||.|.|||||||||||.|.|.||..|||
Yeast    62 GGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVV 126

  Fly   146 FGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            ||:|:.|.::|:::|.|.....:...: ..:|..|||
Yeast   127 FGEVVDGYDIVKKVESLGSPSGATKAR-IVVAKSGEL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 95/163 (58%)
PRK12678 612..>804 CDD:237171
CPR1NP_010439.1 cyclophilin_ABH_like 2..160 CDD:238907 95/163 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.