DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and AT1G01940

DIOPT Version :10

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_171696.2 Gene:AT1G01940 / 839309 AraportID:AT1G01940 Length:160 Species:Arabidopsis thaliana


Alignment Length:149 Identity:68/149 - (45%)
Similarity:87/149 - (58%) Gaps:13/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGT 90
            :|.|..|:|.|..||:||||.|||.  .|:         |.|.||||.:|.||:|.|| ..|.|.
plant     9 LGDIKCEIFCDEVPKSAENFLALCA--SGY---------YDGTIFHRNIKGFMIQGGD-PKGTGK 61

  Fly    91 GGESIYGGTFEDESFEK-KHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQE 154
            ||.||:|..|.||..:. ||:...:|||||.|.||||||||||....|||:.::.:||:||.|.|
plant    62 GGTSIWGKKFNDEIRDSLKHNARGMLSMANSGPNTNGSQFFITYAKQPHLNGLYTIFGKVIHGFE 126

  Fly   155 LVRQLEGLPVDRNSRPLQD 173
            ::..:|........|||.:
plant   127 VLDIMEKTQTGPGDRPLAE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 68/149 (46%)
PRK12678 612..>804 CDD:237171
AT1G01940NP_171696.2 Cyclophilin_PPIL3_like 1..153 CDD:238909 68/149 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.