DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ROC1

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_195585.1 Gene:ROC1 / 830029 AraportID:AT4G38740 Length:172 Species:Arabidopsis thaliana


Alignment Length:170 Identity:97/170 - (57%)
Similarity:123/170 - (72%) Gaps:2/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDF 77
            |:.:||:::.|...||||.||:.|..|:||||||||||||||.| .|||.|.:||..||||:.:|
plant     4 PKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVG-GTGKPLHFKGSKFHRVIPNF 67

  Fly    78 MVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNI 142
            |.|.|||:||||||||||||..||||:||:||..|.:|||||.|.|||||||||.|.....||..
plant    68 MCQGGDFTAGNGTGGESIYGSKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGK 132

  Fly   143 HVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            |||||||:.|.::|:.:|.:. ..:.:|.:...:|:||:|
plant   133 HVVFGQVVEGLDVVKAIEKVG-SSSGKPTKPVVVADCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 94/166 (57%)
SH3-RhoG_link 635..>718 CDD:293215
ROC1NP_195585.1 cyclophilin_ABH_like 4..169 CDD:238907 94/166 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.