DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ROC4

DIOPT Version :10

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001154684.1 Gene:ROC4 / 825376 AraportID:AT3G62030 Length:313 Species:Arabidopsis thaliana


Alignment Length:169 Identity:97/169 - (57%)
Similarity:111/169 - (65%) Gaps:8/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFM 78
            :.:||:.:||...||||..||.:|.|||.|||||||||||.:|        |||..|||::||||
plant   149 KVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYG--------YKGSSFHRIIKDFM 205

  Fly    79 VQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIH 143
            :|.|||:.||||||.||||..||||:|..||..|.:|||||.|.|||||||||.|.....|||.|
plant   206 IQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKH 270

  Fly   144 VVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            |||||||.|.:|||.||.........|.:...|..||||
plant   271 VVFGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGEL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 93/165 (56%)
PRK12678 612..>804 CDD:237171
ROC4NP_001154684.1 cyclophilin_ABH_like 149..307 CDD:238907 93/165 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.