DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and AT2G38730

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_181407.1 Gene:AT2G38730 / 818455 AraportID:AT2G38730 Length:199 Species:Arabidopsis thaliana


Alignment Length:180 Identity:96/180 - (53%)
Similarity:115/180 - (63%) Gaps:8/180 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RDAGATRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGE--KGFGLITGKKLQYKGV 68
            |......|..|||:|:||:..|||..|||.|:|||||||||..||||  |     .||.|.||..
plant    25 RPPNPKNPVVFFDVSIGGIPAGRIKMELFADIAPKTAENFRQFCTGELRK-----AGKPLGYKEC 84

  Fly    69 IFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITT 133
            .||||:||||||:|||...:|:|..||||..||||:|..||..|.||||||.|.||||.|||||.
plant    85 QFHRVIKDFMVQSGDFLKNDGSGCMSIYGHKFEDENFTAKHTGPGLLSMANSGPNTNGCQFFITC 149

  Fly   134 QPAPHLDNIHVVFGQVI-SGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            .....|||.|||||:|: .|..::|::|.:.:..|:||.....|..|||:
plant   150 AKCDWLDNKHVVFGRVLGDGLLVMRKIENVAIGPNNRPKLAVVITECGEM 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 92/169 (54%)
SH3-RhoG_link 635..>718 CDD:293215
AT2G38730NP_181407.1 PLN03149 14..199 CDD:178694 95/178 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.