DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and CYP5

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001318316.1 Gene:CYP5 / 817546 AraportID:AT2G29960 Length:201 Species:Arabidopsis thaliana


Alignment Length:178 Identity:92/178 - (51%)
Similarity:116/178 - (65%) Gaps:2/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRDAGATRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVI 69
            |.|......:.:||:.:.|...||:|..||....||||||||||||||||.|. :||.|.|||..
plant    24 KEDLKEVTHKVYFDVEIDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGK-SGKPLHYKGSK 87

  Fly    70 FHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQ 134
            |||::..||:|.|||:.|||.|||||||..|.||:|:.||..|.:|||||.|::||||||||||.
plant    88 FHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFITTV 152

  Fly   135 PAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            ....||..|||||:|:.|.::|.::|. ...::..|.....||:.|||
plant   153 TTSWLDGRHVVFGKVVQGMDVVYKIEA-EGKQSGTPKSKVVIADSGEL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 87/166 (52%)
SH3-RhoG_link 635..>718 CDD:293215
CYP5NP_001318316.1 cyclophilin_ABH_like 32..197 CDD:238907 87/166 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.