DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and Ppil3

DIOPT Version :10

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_011236892.1 Gene:Ppil3 / 70225 MGIID:1917475 Length:176 Species:Mus musculus


Alignment Length:126 Identity:60/126 - (47%)
Similarity:73/126 - (57%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGT 90
            :|.|..|:|.:..|||.|||.|||...           .|.|.:|||.:|.||||.|| ..|.|.
Mouse     9 VGDIKIEVFCERTPKTCENFLALCASN-----------YYNGCVFHRNIKGFMVQTGD-PTGTGR 61

  Fly    91 GGESIYGGTFEDESFE-KKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVI 150
            ||.||:...||||..| .||:...::||||.|.||||||||||....||||..:.|||:::
Mouse    62 GGSSIWAKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKLL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 60/126 (48%)
PRK12678 612..>804 CDD:237171
Ppil3XP_011236892.1 Cyclophilin_PPIL3_like 1..>122 CDD:238909 60/124 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.