DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and Ppil6

DIOPT Version :10

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001419300.1 Gene:Ppil6 / 685567 RGDID:1592581 Length:332 Species:Rattus norvegicus


Alignment Length:132 Identity:70/132 - (53%)
Similarity:87/132 - (65%) Gaps:1/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQ 80
            |.|||:....:||::|||:.|..|:|..||:.||||..||. ..|.||.||..|||||||:..||
  Rat   147 FLDISIDLAPIGRLIFELYCDACPRTCTNFQVLCTGTSGFS-ERGIKLHYKDSIFHRVVKNGWVQ 210

  Fly    81 AGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVV 145
            .||...|.|..||||||.|||||:|...|::..:|.|.|:|.:||||||:||.|..|:||..:|.
  Rat   211 GGDIVEGRGDDGESIYGPTFEDENFSVPHNKRGVLGMVNKGHHTNGSQFYITLQATPYLDKKYVA 275

  Fly   146 FG 147
            ||
  Rat   276 FG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 70/132 (53%)
PRK12678 612..>804 CDD:237171
Ppil6NP_001419300.1 cyclophilin 146..>277 CDD:469651 68/130 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.