DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ZC250.5

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001123073.1 Gene:ZC250.5 / 6418817 WormBaseID:WBGene00045306 Length:204 Species:Caenorhabditis elegans


Alignment Length:188 Identity:44/188 - (23%)
Similarity:73/188 - (38%) Gaps:37/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FFDISL-GGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLI---TGKKLQYKGVIFHRV-VK 75
            :|||.. .|:.:||::.::...:.....|.|.....||    .:   .|||::|.|.|.|:: ..
 Worm    33 YFDIGFETGVPIGRVIIQMNEALKKNLTELFVKTARGE----FVHPSCGKKIEYTGTILHQISTS 93

  Fly    76 DFMVQAGDFSAGNGTGG-ESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFI--TTQPAP 137
            ..|:..||...|||.|. ..:....|::.:|            ::..:||.|....:  .|.|..
 Worm    94 KNMIMGGDVLNGNGCGRCAPVSRKLFQENNF------------SSTVQNTRGKVILLPSDTNPTV 146

  Fly   138 HLDNIHVV-------------FGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            .....:|:             .|.||.|.|::..:.......|.||.:...:.|||.|
 Worm   147 FSSLFYVLLDKSGPSVVDGCPIGDVIEGIEILETIVKEYGSENGRPGKKLIVHNCGHL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 41/184 (22%)
SH3-RhoG_link 635..>718 CDD:293215
ZC250.5NP_001123073.1 cyclophilin 44..200 CDD:381853 36/171 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.