DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppil6

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001018433.1 Gene:ppil6 / 553623 ZFINID:ZDB-GENE-050522-70 Length:293 Species:Danio rerio


Alignment Length:166 Identity:85/166 - (51%)
Similarity:113/166 - (68%) Gaps:3/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQ 80
            :.||..||..:||::||||:||.|||..||:||||||.|... :..:|.|||.:|||||.:..:|
Zfish   126 YMDIENGGEAVGRLLFELFSDVCPKTCRNFKALCTGEAGLSK-SNLELSYKGSVFHRVVPNGWIQ 189

  Fly    81 AGDFS-AGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHV 144
            .||.| ...|||||||||.|||||:|...|::..:|.|||:|.::|||||:||.|||..:|..:|
Zfish   190 GGDISPEKKGTGGESIYGPTFEDENFVISHNKRGILGMANQGAHSNGSQFYITLQPATWMDQKYV 254

  Fly   145 VFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCG 180
            .|||:..|.:::::||.:|. .|.||.||..|..||
Zfish   255 AFGQLAEGTDVLKRLEAVPT-YNERPKQDCKIVACG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 83/164 (51%)
SH3-RhoG_link 635..>718 CDD:293215
ppil6NP_001018433.1 cyclophilin 125..289 CDD:294131 83/164 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.