DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and PPIL3

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_115861.1 Gene:PPIL3 / 53938 HGNCID:9262 Length:165 Species:Homo sapiens


Alignment Length:158 Identity:62/158 - (39%)
Similarity:81/158 - (51%) Gaps:20/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MGRIVFELFNDVAPKTAENFRALCTGEKG-----FGLITGKKLQYKGVIFHRVVKDFMVQAGDFS 85
            :|.|..|:|.:..|||.| ..:.|..:.|     .|.:......:|.|....:.:          
Human     9 VGDIKIEVFCERTPKTCE-MESRCVPQAGVQWRDLGSLQPPPPGFKQVFCLSLPR---------- 62

  Fly    86 AGNGTGGESIYGGTFEDESFE-KKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQV 149
              .|.||.||:|..||||..| .||:...::||||.|.||||||||||....||||..:.|||:|
Human    63 --TGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKV 125

  Fly   150 ISGQELVRQLEGLPV-DRNSRPLQDAAI 176
            |.|.|.:.:||.||| ::..|||.|..|
Human   126 IDGLETLDELEKLPVNEKTYRPLNDVHI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 62/158 (39%)
SH3-RhoG_link 635..>718 CDD:293215
PPIL3NP_115861.1 cyclophilin 1..158 CDD:294131 62/158 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.