DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and PPIL1

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:165 Identity:67/165 - (40%)
Similarity:89/165 - (53%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDF 77
            |..:.:.|     ||.||.||:...||||.:||..|  ..:|:         |.|..|||::|||
Human    12 PNVYLETS-----MGIIVLELYWKHAPKTCKNFAEL--ARRGY---------YNGTKFHRIIKDF 60

  Fly    78 MVQAGDFSAGNGTGGESIYGGTFEDESF-EKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDN 141
            |:|.|| ..|.|.||.||||..||||.. :.|.....:|:|||.|.:|||||||:|..|...||.
Human    61 MIQGGD-PTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDG 124

  Fly   142 IHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAI 176
            .|.:||:|..|..:|.::..:..:...||:.|..|
Human   125 KHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKI 159

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 67/165 (41%)
SH3-RhoG_link 635..>718 CDD:293215
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 66/162 (41%)
Cyclosporin A binding. /evidence=ECO:0000305|PubMed:16595688 54..65 7/10 (70%)