DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppih

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_957499.1 Gene:ppih / 494165 ZFINID:ZDB-GENE-040625-127 Length:181 Species:Danio rerio


Alignment Length:161 Identity:85/161 - (52%)
Similarity:105/161 - (65%) Gaps:5/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VNKRDAGATRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGE-KGFGLITGKKLQYK 66
            :|.:.:....|..|||:|:||..:||:..|||.|:.||||||||..|||| |..|:..|    ||
Zfish     1 MNVQPSNPNNPIVFFDVSIGGQEVGRMKIELFADIVPKTAENFRQFCTGEFKKDGVPVG----YK 61

  Fly    67 GVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFI 131
            |..||||:||||:|.|||..|:|||..|||.|.|.||:|..||..|.||||||.|..|||.||||
Zfish    62 GCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENFRMKHSGPGLLSMANSGPGTNGCQFFI 126

  Fly   132 TTQPAPHLDNIHVVFGQVISGQELVRQLEGL 162
            |......||..|||||:|:.|..::|::|.:
Zfish   127 TCTKCDWLDGKHVVFGKVVDGLLVMRKIEAV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 84/151 (56%)
SH3-RhoG_link 635..>718 CDD:293215
ppihNP_957499.1 cyclophilin_ABH_like 11..175 CDD:238907 84/151 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.