DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppif

DIOPT Version :10

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001244029.1 Gene:ppif / 493394 XenbaseID:XB-GENE-1008626 Length:200 Species:Xenopus tropicalis


Alignment Length:170 Identity:87/170 - (51%)
Similarity:109/170 - (64%) Gaps:9/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDF 77
            |..:.|:......:||:.|||..||.||||||||||||||||||        |||..|||::.:|
 Frog    39 PMVYMDLVADNQPLGRVTFELRADVVPKTAENFRALCTGEKGFG--------YKGSTFHRIIPNF 95

  Fly    78 MVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNI 142
            |.|.|||:..|||||:||||..|.||:|..||..|.::||||.|.|||||||||.|.....|||.
 Frog    96 MCQGGDFTNHNGTGGKSIYGSRFPDENFFLKHTGPGVVSMANAGPNTNGSQFFICTVETEWLDNK 160

  Fly   143 HVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            |||||.:..|.::::::|... .:..||.:...:|.||||
 Frog   161 HVVFGCIKDGYDIMKKIESFG-SKTGRPSKKVVVAECGEL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 83/166 (50%)
PRK12678 612..>804 CDD:237171
ppifNP_001244029.1 cyclophilin_ABH_like 39..197 CDD:238907 83/166 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.