DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppifa

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001004626.1 Gene:ppifa / 447887 ZFINID:ZDB-GENE-040912-52 Length:189 Species:Danio rerio


Alignment Length:172 Identity:92/172 - (53%)
Similarity:109/172 - (63%) Gaps:13/172 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDF 77
            |..|.||:..|..:|||:.|||.||.|||..|||||||||.|||        |||.:|||::.:|
Zfish    28 PVVFMDIAADGEFIGRIIIELFADVVPKTVANFRALCTGEHGFG--------YKGSVFHRIIPEF 84

  Fly    78 MVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNI 142
            |.|.|||:..|||||:||||..|.||:|:.||....:|||||.|.|||||||||.|.....||..
Zfish    85 MCQGGDFTNHNGTGGKSIYGKKFNDENFKLKHTGAGILSMANSGPNTNGSQFFICTAKTEWLDGK 149

  Fly   143 HVVFGQVISGQELVRQLE--GLPVDRNSRPLQDAAIANCGEL 182
            |||||||..|.|.|..:|  ||   .:...::..||.:||||
Zfish   150 HVVFGQVKEGMETVSLMESYGL---HDGGTVKKVAITDCGEL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 88/168 (52%)
SH3-RhoG_link 635..>718 CDD:293215
ppifaNP_001004626.1 cyclophilin_ABH_like 28..186 CDD:238907 88/168 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.