DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppil3

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001002146.1 Gene:ppil3 / 415236 ZFINID:ZDB-GENE-040625-159 Length:161 Species:Danio rerio


Alignment Length:153 Identity:73/153 - (47%)
Similarity:92/153 - (60%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGT 90
            :|.:..|||.:.|||:.|||.|||.|  ||         |.|.||||.:|.|:||.|| ..|.|.
Zfish     9 LGDMKIELFCEKAPKSCENFLALCAG--GF---------YNGCIFHRNIKGFIVQTGD-PTGTGK 61

  Fly    91 GGESIYGGTFEDESFEK-KHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQE 154
            ||.||:|..||||..|. ||:...:::|||.|.|||.||||.|....||||..:.|||::|.|.|
Zfish    62 GGTSIWGRKFEDEFSEHLKHNVRGVVAMANNGPNTNASQFFFTYAKQPHLDMKYTVFGKIIDGLE 126

  Fly   155 LVRQLEGLPV-DRNSRPLQDAAI 176
            .:.::|.||| ::..|||.|..|
Zfish   127 TLDEIEKLPVNEKTFRPLNDVRI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 73/153 (48%)
SH3-RhoG_link 635..>718 CDD:293215
ppil3NP_001002146.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 73/153 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.