DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppil2

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_957285.2 Gene:ppil2 / 393966 ZFINID:ZDB-GENE-040426-1096 Length:524 Species:Danio rerio


Alignment Length:235 Identity:83/235 - (35%)
Similarity:116/235 - (49%) Gaps:28/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTG 91
            |.:..||..|..||..|||..||  :||:         |.|.:|||.:::||:|.|| ..|.|||
Zfish   289 GDLNVELHCDKVPKAGENFIKLC--KKGY---------YDGTVFHRSIRNFMIQGGD-PTGTGTG 341

  Fly    92 GESIYGGTFEDESFEK--KHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQE 154
            |||.:|..|:|| |..  .|....:|||||.|.|||.||||||.:...:||..|.|||:|:.|.|
Zfish   342 GESFWGKPFKDE-FRPNLSHTGRGILSMANSGPNTNKSQFFITFRSCAYLDRKHSVFGRVVGGLE 405

  Fly   155 LVRQLEGLPVD-RNSRPLQDAAIANCGELV-------RQTKAKKEKK----HKRRSTATEDSNSE 207
            .:..:|.:..| :..:|..:..|.:....|       .|..|::||:    .:.|:..:...|..
Zfish   406 TLSAMENVESDPKTDKPKSEIKILSTSVFVDPYEEADAQIAAEREKEAQKVEEERAQTSALVNKA 470

  Fly   208 ESEAEAKVVRKAKKKKRSRKDTK-SQSDSEDNETSRGNGK 246
            ::|.:.|..|....|..:...|| |..|:|...||....|
Zfish   471 KTEEKPKAFRPGVGKYINMSATKHSHPDAEKPSTSEAPAK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 64/155 (41%)
SH3-RhoG_link 635..>718 CDD:293215
ppil2NP_957285.2 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 65/163 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.