DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and Cypl

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster


Alignment Length:168 Identity:70/168 - (41%)
Similarity:94/168 - (55%) Gaps:22/168 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGT 90
            ||.|..||:...||.|..||..|  ..:|:         |..|:|||:::|||:|.|| ..|.|.
  Fly    29 MGEITVELYWKHAPNTCRNFAEL--SRRGY---------YNNVVFHRIIRDFMIQGGD-PTGTGR 81

  Fly    91 GGESIYGGTFEDESF-EKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQE 154
            ||.||||..|.||.. :.:|....:|||||.|.:|||||||||..|...||..|.:||:|.:|.|
  Fly    82 GGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGME 146

  Fly   155 LVRQLEGLPVDRNSRPLQDAAIANCGELVRQTKAKKEK 192
            :|:::..:..|:|.||:         :.:|..|||.||
  Fly   147 VVKRIGMVETDKNDRPV---------DPLRIIKAKVEK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 64/154 (42%)
SH3-RhoG_link 635..>718 CDD:293215
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 65/161 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447189
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.