DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and CG3511

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001286847.1 Gene:CG3511 / 37926 FlyBaseID:FBgn0035027 Length:637 Species:Drosophila melanogaster


Alignment Length:152 Identity:73/152 - (48%)
Similarity:86/152 - (56%) Gaps:14/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTG 91
            |.|...||....|||.|||   |        :..|...|.|.|||||:|.||||.|| ..|.|||
  Fly   491 GDIHMRLFFKEVPKTVENF---C--------VHAKNGYYNGHIFHRVIKGFMVQTGD-PTGTGTG 543

  Fly    92 GESIYGGTFEDESFEK-KHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQEL 155
            |:||:|..|:||.... |||||:.:||||.|.||||||||||..|.|.|||.|.|||:|..|.|:
  Fly   544 GKSIWGSDFKDEFVPSLKHDRPYTVSMANAGPNTNGSQFFITVLPTPWLDNKHTVFGRVYRGMEV 608

  Fly   156 VRQLEGLPVD-RNSRPLQDAAI 176
            |..:.....: :..:|..|..|
  Fly   609 VLNICNSKANPKTDKPYDDIKI 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 73/152 (48%)
SH3-RhoG_link 635..>718 CDD:293215
CG3511NP_001286847.1 WD40 <75..>312 CDD:225201
WD40 <79..300 CDD:295369
WD40 repeat 85..122 CDD:293791
WD40 repeat 128..176 CDD:293791
WD40 repeat 181..210 CDD:293791
WD40 repeat 218..268 CDD:293791
WD40 repeat 275..311 CDD:293791
cyclophilin_WD40 485..633 CDD:238908 73/152 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447241
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.