DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and Cwc27

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_017446439.1 Gene:Cwc27 / 361887 RGDID:1310697 Length:471 Species:Rattus norvegicus


Alignment Length:566 Identity:149/566 - (26%)
Similarity:213/566 - (37%) Gaps:163/566 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTG 91
            |.|..||::..|||...||..||.           :..|...||||||..|:||.|| ..|.|||
  Rat    22 GDIDIELWSKEAPKACRNFIQLCL-----------EAYYDNTIFHRVVPGFIVQGGD-PTGTGTG 74

  Fly    92 GESIYGGTFEDESFEK-KHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQEL 155
            |||:||..|:||...: :.:|..|::|||.|.:.||||||.|...|..|:|.|.:||:| :|..:
  Rat    75 GESVYGAPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFFTLGRADELNNKHTIFGKV-TGDTV 138

  Fly   156 --VRQLEGLPVDRNSRPLQDAAIANCGELV--------------RQTKAKKE-KKHKRRSTATED 203
              :.:|..:.:|...||.....|.:|..|.              ::.||::| ||.|.:.|....
  Rat   139 YNMLRLTEVDIDDEERPRNPHRIKSCEVLFNPFDDIIPREIKKPKKEKAEEEIKKLKPKGTKNFS 203

  Fly   204 --SNSEESEAEAKVVRKAKKKKRSRKDTKSQSD------------SEDNETSRGNGKHDQTPQD- 253
              |..||:|.|.:.|.:..:..:.|  :||..|            :.::|.....|..:...|| 
  Rat   204 LLSFGEEAEEEEEEVNRVSQSMKGR--SKSSHDLLKDDPHLSSVPAVESEKDDATGDLEDLSQDA 266

  Fly   254 -DDEDREEGELHPLVTITKIDPNEIPEVSNKFLMRAERSKSLDREERGARGQDRDRGKDQDRDRS 317
             ||....:|.:               |...|.|||...:|.|                  .:|.|
  Rat   267 EDDSVEHDGSM---------------EEDEKNLMRERIAKRL------------------KKDAS 298

  Fly   318 RNNFGWSKKQAPPTSRSGRIVKGRGVFRFRTPSRSRSRSTTPPHWKHAQKRTIKLSDLERIEEES 382
            .|                  ||..|....:..|||                           ||.
  Rat   299 AN------------------VKSAGDGEKKPASRS---------------------------EEL 318

  Fly   383 KMREEEMKRREHERKRRHEEATKNPKQSFFELSHASTYGGKITPDRFSPEH-KAKSKDTADRGKA 446
            :....::||.....|::.|.|||..|.|..|         :..||....|: :.|.|..|.|   
  Rat   319 RKEARQLKRELLAAKQKKESATKAEKGSEEE---------EAVPDGPVAEYRREKQKYEALR--- 371

  Fly   447 KEREKAGEKDKARDVTPVKRRKSMDMNALDYEQQTESEVESEDEE------------QLKVKPPS 499
            |::.|.|...:.:.:..:.:.||....|:....:..:|.|.||:|            ..|||..|
  Rat   372 KQQPKKGTSREDQTLALLSQFKSKLTQAITEMPENCAEAEVEDDEGWMSHVLQFEDKTRKVKDAS 436

  Fly   500 KQDIRVEPSTSKDRNAKRDERKPTEEKAKPKRSRSRSPRRQSPARR 545
            .||        .|.....|.|.|..   |.:|..|:...|:...||
  Rat   437 MQD--------SDTFEIYDPRNPVN---KRRREESKKLLREKKERR 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 61/155 (39%)
SH3-RhoG_link 635..>718 CDD:293215
Cwc27XP_017446439.1 cyclophilin_CeCYP16-like 8..177 CDD:238906 63/167 (38%)
TMEM119 <308..>359 CDD:292352 17/86 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.