DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppiaa

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_997923.1 Gene:ppiaa / 336612 ZFINID:ZDB-GENE-030131-8556 Length:164 Species:Danio rerio


Alignment Length:171 Identity:88/171 - (51%)
Similarity:111/171 - (64%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKD 76
            ||:.|||::.||..:||:|.||..||.|:||||||.||||:.|:|        |||..||||:..
Zfish     3 RPKVFFDLTAGGNPVGRVVMELRADVVPRTAENFRQLCTGQPGYG--------YKGSSFHRVIPG 59

  Fly    77 FMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDN 141
            ||.|.|||:..|||||:||||..|.||:|..||.....|||||.|.|||||||||.|.....||.
Zfish    60 FMCQGGDFTNHNGTGGKSIYGNKFADENFNLKHTGAGCLSMANAGPNTNGSQFFICTALTSWLDG 124

  Fly   142 IHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            .|||||||:.|.::::::||.. ..:.:......||:||:|
Zfish   125 KHVVFGQVVEGLDVIKKVEGFG-SSSGKTSAKIIIADCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 84/166 (51%)
SH3-RhoG_link 635..>718 CDD:293215
ppiaaNP_997923.1 cyclophilin_ABH_like 4..162 CDD:238907 84/166 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579536
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.