DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppiab

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001315353.1 Gene:ppiab / 335519 ZFINID:ZDB-GENE-030131-7459 Length:164 Species:Danio rerio


Alignment Length:172 Identity:96/172 - (55%)
Similarity:111/172 - (64%) Gaps:13/172 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDF 77
            |:.||||::.|...||||.||..||.||||||||||||||||||        |||..||||:..|
Zfish     4 PKVFFDITIDGKEAGRIVMELRADVVPKTAENFRALCTGEKGFG--------YKGSGFHRVIPQF 60

  Fly    78 MVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNI 142
            |.|.|||:..|||||:||||..||||:|..||.....|||||.|.|||||||||.|.....||..
Zfish    61 MCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHGGKGTLSMANAGPNTNGSQFFICTADTNWLDGK 125

  Fly   143 HVVFGQVISGQELVRQLE--GLPVDRNSRPLQDAAIANCGEL 182
            |||||:|:.|.::|..:|  |....:.|..:   .|||||:|
Zfish   126 HVVFGKVVDGLDVVDAIEKKGSSSGKCSAKV---VIANCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 93/168 (55%)
SH3-RhoG_link 635..>718 CDD:293215
ppiabNP_001315353.1 cyclophilin_ABH_like 4..162 CDD:238907 93/168 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.