DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and CG15767

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster


Alignment Length:179 Identity:48/179 - (26%)
Similarity:74/179 - (41%) Gaps:25/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RPRCFFDISL-GGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRV-V 74
            |||......| .|..:|::|.:|:.:.||.....|...|.|::.......:       ||.|: |
  Fly   203 RPRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEFAVRR-------IFPRLWV 260

  Fly    75 KDFMVQAGDFSAGNGTGGES--IYGGTFEDESFEKKHDR-PFLLSMAN----RGKNTNGSQFFIT 132
            :.:::.    |..|..|..|  .|....|.::....|.| .|:||.|.    .|.......|.|:
  Fly   261 EGYLLS----SCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSIS 321

  Fly   133 TQPAPHLDNIHVVFGQVISGQELVRQLE--GLPVDRNSRPLQDAAIANC 179
            .:|.|......|.||:||.|.:::..:|  |....:.||||   .|.:|
  Fly   322 FKPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKNGKISRPL---LITHC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 47/178 (26%)
SH3-RhoG_link 635..>718 CDD:293215
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 48/179 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.