DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and Ppil1

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001029360.1 Gene:Ppil1 / 309651 RGDID:1309119 Length:166 Species:Rattus norvegicus


Alignment Length:165 Identity:67/165 - (40%)
Similarity:89/165 - (53%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDF 77
            |..:.:.|     ||.||.||:...||||.:||..|  ..:|:         |.|..|||::|||
  Rat    12 PNVYLETS-----MGIIVLELYWKHAPKTCKNFAEL--ARRGY---------YNGTKFHRIIKDF 60

  Fly    78 MVQAGDFSAGNGTGGESIYGGTFEDESF-EKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDN 141
            |:|.|| ..|.|.||.||||..||||.. :.|.....:|:|||.|.:|||||||:|..|...||.
  Rat    61 MIQGGD-PTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDG 124

  Fly   142 IHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAI 176
            .|.:||:|..|..:|.::..:..:...||:.|..|
  Rat   125 KHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 67/165 (41%)
SH3-RhoG_link 635..>718 CDD:293215
Ppil1NP_001029360.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 66/162 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.