DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and Ppil1

DIOPT Version :10

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001029360.1 Gene:Ppil1 / 309651 RGDID:1309119 Length:166 Species:Rattus norvegicus


Alignment Length:165 Identity:67/165 - (40%)
Similarity:89/165 - (53%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDF 77
            |..:.:.|     ||.||.||:...||||.:||..|  ..:|:         |.|..|||::|||
  Rat    12 PNVYLETS-----MGIIVLELYWKHAPKTCKNFAEL--ARRGY---------YNGTKFHRIIKDF 60

  Fly    78 MVQAGDFSAGNGTGGESIYGGTFEDESF-EKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDN 141
            |:|.|| ..|.|.||.||||..||||.. :.|.....:|:|||.|.:|||||||:|..|...||.
  Rat    61 MIQGGD-PTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDG 124

  Fly   142 IHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAI 176
            .|.:||:|..|..:|.::..:..:...||:.|..|
  Rat   125 KHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 67/165 (41%)
PRK12678 612..>804 CDD:237171
Ppil1NP_001029360.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 66/162 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.