DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and Ppic

DIOPT Version :10

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001004215.1 Gene:Ppic / 291463 RGDID:1303221 Length:212 Species:Rattus norvegicus


Alignment Length:181 Identity:95/181 - (52%)
Similarity:117/181 - (64%) Gaps:11/181 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VNKRDAGATRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKG 67
            |.||....| .:.|||:.:|...:||||..||..|.|:|.|||..|.|||||:|        |||
  Rat    29 VRKRGPLVT-DKVFFDVRIGDKDVGRIVIGLFGKVVPRTVENFVTLATGEKGYG--------YKG 84

  Fly    68 VIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFIT 132
            .|||||:||||:|.|||:|.:||||.||||.||.||:|:.||.....:||||.|.:|||||||||
  Rat    85 SIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFIT 149

  Fly   133 -TQPAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
             |:|| .||..|||||:|:.|..:|..:|....|.:.|||.|..|.|.|::
  Rat   150 LTKPA-WLDGKHVVFGKVLDGMTVVHSIELQATDDHDRPLTDCTIVNSGKI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 90/167 (54%)
PRK12678 612..>804 CDD:237171
PpicNP_001004215.1 cyclophilin_ABH_like 38..197 CDD:238907 90/167 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.