DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and cyp1

DIOPT Version :10

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_593308.1 Gene:cyp1 / 2543019 PomBaseID:SPAC57A10.03 Length:155 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:66/152 - (43%)
Similarity:92/152 - (60%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGT 90
            :|:|:.||:.:.||||.:||..|  .::|:         |.|||||||:.||::|.|| ..|.|.
pombe    10 LGKILIELYTEHAPKTCQNFYTL--AKEGY---------YDGVIFHRVIPDFVIQGGD-PTGTGR 62

  Fly    91 GGESIYGGTFEDE-SFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQE 154
            ||.||||..|:|| ..:..|....:|||||.|.|||.||||||..|.|.||..|.:||:|:||..
pombe    63 GGTSIYGDKFDDEIHSDLHHTGAGILSMANAGPNTNSSQFFITLAPTPWLDGKHTIFGRVVSGLS 127

  Fly   155 LVRQLEGLPVDRNSRPLQDAAI 176
            :.:::..:..|.:.||::...|
pombe   128 VCKRMGLIRTDSSDRPIEPLKI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 66/152 (43%)
PRK12678 612..>804 CDD:237171
cyp1NP_593308.1 cyclophilin 6..151 CDD:469651 66/152 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.