DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppi1

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_595664.1 Gene:ppi1 / 2540269 PomBaseID:SPBC28F2.03 Length:162 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:90/148 - (60%)
Similarity:108/148 - (72%) Gaps:8/148 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMV 79
            ||||:...|..:|||||:||:||.||||.|||||||||||:|        |.|..||||:..||:
pombe     4 CFFDVIANGQPLGRIVFKLFDDVVPKTAANFRALCTGEKGYG--------YAGSTFHRVIPQFML 60

  Fly    80 QAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHV 144
            |.|||:.||||||:||||..|.||:|..||::|.||||||.|.|||||||||||...|.||..||
pombe    61 QGGDFTRGNGTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNGSQFFITTVVTPWLDGKHV 125

  Fly   145 VFGQVISGQELVRQLEGL 162
            |||:|..|.::|:::|.|
pombe   126 VFGEVTEGMDVVKKVESL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 90/148 (61%)
SH3-RhoG_link 635..>718 CDD:293215
ppi1NP_595664.1 cyclophilin_ABH_like 2..160 CDD:238907 90/148 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.