DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and CG30350

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:188 Identity:34/188 - (18%)
Similarity:67/188 - (35%) Gaps:47/188 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RPRCFFDISL-GGLGMGRIVFELFNDVAPKTAENF--RALCTGEKGFG--------------LIT 59
            |||.:||:.| ....:||.|.:|:.:.||......  ..:|.....|.              :::
  Fly   212 RPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLETDLMLS 276

  Fly    60 GKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNT 124
            ...|.::.:.:...|.|                   :|.:....||.|.:...|          |
  Fly   277 SDSLLHQPLEYDAKVID-------------------HGASSYVLSFSKAYVTGF----------T 312

  Fly   125 NGSQFFITTQPAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            :...|.|:.:|...::...|.||:::.|.::...::.... :|.:..:.....:||.|
  Fly   313 HHLSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGT-KNGKLSRGLLFTSCGLL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 30/183 (16%)
SH3-RhoG_link 635..>718 CDD:293215
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 33/186 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.