DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and PPIL2

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_011528343.1 Gene:PPIL2 / 23759 HGNCID:9261 Length:616 Species:Homo sapiens


Alignment Length:257 Identity:84/257 - (32%)
Similarity:124/257 - (48%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTG 91
            |.:..||..|:.|||.|||..||           ||..|.|.||||.:::|::|.|| ..|.|||
Human   289 GDLNLELHCDLTPKTCENFIRLC-----------KKHYYDGTIFHRSIRNFVIQGGD-PTGTGTG 341

  Fly    92 GESIYGGTFEDESFEK--KHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQE 154
            |||.:|..|:|| |..  .|....:|||||.|.|:|.||||||.:...:||..|.:||:|:.|.:
Human   342 GESYWGKPFKDE-FRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFD 405

  Fly   155 LVRQLEGLPVD-RNSRPLQDAAIANCGELVRQTKAKKEKKHKRRSTATEDSNSEESEAEAKVVRK 218
            ::..:|.:..| :..||                      |.:.|..||........||:|::.::
Human   406 VLTAMENVESDPKTDRP----------------------KEEIRIDATTVFVDPYEEADAQIAQE 448

  Fly   219 AKKKKRSRKDTK-----SQSDSEDNETSR-GNGKHDQTPQDDDEDREEGELHPLVTITKIDP 274
            .|.:.:...:||     .|:.|:..:|.| |.||: ..|...::.|:..:..||....:..|
Human   449 RKTQLKVAPETKVKSSQPQAGSQGPQTFRQGVGKY-INPAATEQQRKSPQPVPLSPCPRRSP 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 62/155 (40%)
SH3-RhoG_link 635..>718 CDD:293215
PPIL2XP_011528343.1 RING-Ubox_PPIL2 38..110 CDD:319577
RING_Ubox 100..159 CDD:388418
U-box domain, a modified RING finger 103..146 CDD:319361
cyclophilin_RING 281..440 CDD:238904 66/185 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.