DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and Ppic

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_032934.1 Gene:Ppic / 19038 MGIID:97751 Length:212 Species:Mus musculus


Alignment Length:180 Identity:94/180 - (52%)
Similarity:115/180 - (63%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VNKRDAGATRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKG 67
            |.||....| .:.|||:.:|...:||||..||.:|.|||.|||.||.|||||:|        |||
Mouse    29 VRKRGPSVT-DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG--------YKG 84

  Fly    68 VIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFIT 132
            .|||||:||||:|.|||:|.:||||.||||.||.||:|:.||.....:||||.|.:|||||||||
Mouse    85 SIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFIT 149

  Fly   133 TQPAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            ......||..|||||:|:.|..:|..:|....|.:.|||.|..|.|.|::
Mouse   150 LTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 89/166 (54%)
SH3-RhoG_link 635..>718 CDD:293215
PpicNP_032934.1 cyclophilin_ABH_like 38..197 CDD:238907 89/166 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.