DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and cyn-7

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_506749.1 Gene:cyn-7 / 180027 WormBaseID:WBGene00000883 Length:171 Species:Caenorhabditis elegans


Alignment Length:172 Identity:98/172 - (56%)
Similarity:125/172 - (72%) Gaps:2/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVK 75
            :|||.||||::.|...||||.||:||:.||||||||||||||||.|. :||.|.:||..|||::.
 Worm     2 SRPRVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGK-SGKPLHFKGSKFHRIIP 65

  Fly    76 DFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLD 140
            :||:|.|||:.|||||||||||..|.||:|::||..|.:|||||.|.||||||||:.|.....||
 Worm    66 EFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLD 130

  Fly   141 NIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            ..|||||:|:.|.::|.::|| ....:..|..:..||:||:|
 Worm   131 GKHVVFGRVVEGLDIVSKVEG-NGSSSGTPKSECLIADCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 94/166 (57%)
SH3-RhoG_link 635..>718 CDD:293215
cyn-7NP_506749.1 cyclophilin_ABH_like 4..169 CDD:238907 94/166 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158777
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.