DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and cyn-10

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001021890.1 Gene:cyn-10 / 174132 WormBaseID:WBGene00000886 Length:161 Species:Caenorhabditis elegans


Alignment Length:153 Identity:71/153 - (46%)
Similarity:87/153 - (56%) Gaps:13/153 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTG 91
            |.|..||:.|.|||..|||.|||..:           .|.|.||||.:||||||.|| ...:|.|
 Worm    10 GDIKIELYVDDAPKACENFLALCASD-----------YYNGCIFHRNIKDFMVQTGD-PTHSGKG 62

  Fly    92 GESIYGGTFEDESFEK-KHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQEL 155
            ||||:||.||||.... |||....:||||.|.::|.||||||.....|||..:.:||:||.|.:.
 Worm    63 GESIWGGPFEDEFVSALKHDSRGCVSMANNGPDSNRSQFFITYAKQAHLDMKYTLFGKVIDGFDT 127

  Fly   156 VRQLEGLPVDRNSRPLQDAAIAN 178
            :.::|.:.||...|||....|.|
 Worm   128 LEEIETIKVDNKYRPLVQQKIQN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 71/153 (46%)
SH3-RhoG_link 635..>718 CDD:293215
cyn-10NP_001021890.1 Cyclophilin_PPIL3_like 1..153 CDD:238909 71/153 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.