DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and PPIAL4H

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001355057.1 Gene:PPIAL4H / 105371242 HGNCID:53889 Length:164 Species:Homo sapiens


Alignment Length:166 Identity:81/166 - (48%)
Similarity:101/166 - (60%) Gaps:9/166 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQ 80
            ||||::.|..:|||..:||.|..||||||||||.||||||        :|||..|||::..||.|
Human     7 FFDITVDGKPLGRISIKLFADKIPKTAENFRALSTGEKGF--------RYKGSCFHRIIPGFMCQ 63

  Fly    81 AGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVV 145
            .|||:..|||..:||||..|:||:..:||....:|||.|.|.||||||.||.|.....||..||.
Human    64 GGDFTRPNGTDDKSIYGEKFDDENLIRKHTGSGILSMVNAGPNTNGSQLFICTAKTEWLDGKHVA 128

  Fly   146 FGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGE 181
            ||:|.....:|..:|.... |||:..:...||:||:
Human   129 FGKVKERVNIVEAMEHFGY-RNSKTSKKITIADCGQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 79/163 (48%)
SH3-RhoG_link 635..>718 CDD:293215
PPIAL4HNP_001355057.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.