DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and PPIE

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_001181936.1 Gene:PPIE / 10450 HGNCID:9258 Length:314 Species:Homo sapiens


Alignment Length:214 Identity:93/214 - (43%)
Similarity:117/214 - (54%) Gaps:37/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NKRDAGA------------------TRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCT 50
            ||.:.|:                  :.|:.:.||.:|....|||...|.:||.|.||||||.|||
Human   113 NKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCT 177

  Fly    51 GEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLL 115
            .|||||        :||..|||::..||.|.|||:..|||||:||||..|:||:|..||..|.||
Human   178 HEKGFG--------FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLL 234

  Fly   116 SMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQELVRQLEGLP-----VDRNSRPLQDAA 175
            ||||.|.||||||||:|......||..|||||:|..|.:::||:|..|     ..|.||..:|..
Human   235 SMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEVAPDTKASKARGSRKNKDGQ 299

  Fly   176 IANCGELVRQTKAKKEKKH 194
            ..|.|      |::|.:.|
Human   300 ERNWG------KSQKVESH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 86/171 (50%)
SH3-RhoG_link 635..>718 CDD:293215
PPIENP_001181936.1 RRM <5..>84 CDD:223796
RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 140..279 CDD:238907 79/146 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.