DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and CWC27

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_005860.2 Gene:CWC27 / 10283 HGNCID:10664 Length:472 Species:Homo sapiens


Alignment Length:564 Identity:152/564 - (26%)
Similarity:216/564 - (38%) Gaps:158/564 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGTG 91
            |.|..||::..|||...||..||.           :..|...||||||..|:||.|| ..|.|:|
Human    22 GDIDIELWSKEAPKACRNFIQLCL-----------EAYYDNTIFHRVVPGFIVQGGD-PTGTGSG 74

  Fly    92 GESIYGGTFEDESFEK-KHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQEL 155
            ||||||..|:||...: :.:|..|::|||.|.:.||||||.|...|..|:|.|.:||:| :|..:
Human    75 GESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKV-TGDTV 138

  Fly   156 --VRQLEGLPVDRNSRPLQDAAIANC------------GELVRQTKAKKE---KKHKRRSTAT-- 201
              :.:|..:.:|.:.||.....|.:|            .|:.|..|.|.|   ||.|.:.|..  
Human   139 YNMLRLSEVDIDDDERPHNPHKIKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFS 203

  Fly   202 -----EDSNSEESEAEAKVVRKAKKKKRSR----KDTKSQSDSEDNETSRGNGKHDQTPQDDDED 257
                 |::..||.|.. :|.:..|.|.:|.    ||....|.....|:.:|:.. |.....:||.
Human   204 LLSFGEEAEEEEEEVN-RVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAP-DLVDDGEDES 266

  Fly   258 REEGELHPLVTITKIDPNEIPEVSNKFLMRAERSKSLDREERGARGQDRDRGKDQDRDRSRNNFG 322
            .|..|.        ||.:|      |.|||...:|.|                  .:|.|.|   
Human   267 AEHDEY--------IDGDE------KNLMRERIAKKL------------------KKDTSAN--- 296

  Fly   323 WSKKQAPPTSRSGRIVKGRGVFRFRTPSRSRSRSTTPPHWKHAQ--KRTIKLSDLERIEEESKMR 385
                           ||..|.......|.|||....    |.|:  ||.:..:..:::|..:|..
Human   297 ---------------VKSAGEGEVEKKSVSRSEELR----KEARQLKRELLAAKQKKVENAAKQA 342

  Fly   386 EEEMKRREHERKRRHEEATKNPKQSFFELSHASTYGGKITPDRFSPEH-KAKSKDTADRGKAKER 449
            |          ||..||                    :..||....|: :.|.|..|.|   |::
Human   343 E----------KRSEEE--------------------EAPPDGAVAEYRREKQKYEALR---KQQ 374

  Fly   450 EKAGEKDKARDVTPVKRRKSMDMNALDYEQQT---ESEVESE----------DEEQLKVKPPSKQ 501
            .|.|...:.:.:..:.:.||....|:....:.   |:|||.:          :::..|||..|.|
Human   375 SKKGTSREDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWMSHVLQFEDKSRKVKDASMQ 439

  Fly   502 DIRVEPSTSKDRNAKRDERKPTEEKAKPKRSRSRSPRRQSPARR 545
            |        .|.....|.|.|..   |.:|..|:...|:...||
Human   440 D--------SDTFEIYDPRNPVN---KRRREESKKLMREKKERR 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 62/167 (37%)
SH3-RhoG_link 635..>718 CDD:293215
CWC27NP_005860.2 cyclophilin_CeCYP16-like 8..178 CDD:238906 62/168 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..386 58/268 (22%)
DUF5401 <302..>472 CDD:375164 46/217 (21%)
CWC27_CTD 376..428 CDD:412084 9/51 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..472 19/84 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.