DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and PPIF

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:NP_005720.1 Gene:PPIF / 10105 HGNCID:9259 Length:207 Species:Homo sapiens


Alignment Length:170 Identity:90/170 - (52%)
Similarity:109/170 - (64%) Gaps:9/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDF 77
            |..:.|:...|..:||:|.||..||.||||||||||||||||||        |||..||||:..|
Human    46 PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG--------YKGSTFHRVIPSF 102

  Fly    78 MVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNI 142
            |.|||||:..|||||:||||..|.||:|..||..|.:|||||.|.|||||||||.|.....||..
Human   103 MCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGK 167

  Fly   143 HVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182
            |||||.|..|.::|:::|... .::.|..:...|.:||:|
Human   168 HVVFGHVKEGMDVVKKIESFG-SKSGRTSKKIVITDCGQL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 87/166 (52%)
SH3-RhoG_link 635..>718 CDD:293215
PPIFNP_005720.1 cyclophilin_ABH_like 46..204 CDD:238907 87/166 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.