DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and ppic

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_002931773.2 Gene:ppic / 100494684 XenbaseID:XB-GENE-948735 Length:208 Species:Xenopus tropicalis


Alignment Length:167 Identity:84/167 - (50%)
Similarity:108/167 - (64%) Gaps:8/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFM 78
            :.||::.:||...||||..||..|.|||.:||.||.|||||:|        |||..||||:||||
 Frog    33 KVFFNVEIGGTDAGRIVIGLFGKVVPKTVKNFVALATGEKGYG--------YKGSRFHRVIKDFM 89

  Fly    79 VQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIH 143
            :|.||.:.|:||||:||||.||.||:|:.||.....:||||.|.:||||||||:|.....|:..|
 Frog    90 IQGGDVTNGDGTGGKSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFISTTRPLWLNGKH 154

  Fly   144 VVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCG 180
            ||||:|:.|..:|..:|....:...:||:|..|.|.|
 Frog   155 VVFGKVLEGMAVVHLIELQQTNERDQPLKDCVIVNSG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 83/165 (50%)
SH3-RhoG_link 635..>718 CDD:293215
ppicXP_002931773.2 cyclophilin 33..191 CDD:294131 83/165 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.