DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moca-cyp and LOC100488106

DIOPT Version :9

Sequence 1:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster
Sequence 2:XP_004912407.1 Gene:LOC100488106 / 100488106 -ID:- Length:147 Species:Xenopus tropicalis


Alignment Length:137 Identity:79/137 - (57%)
Similarity:93/137 - (67%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVKDFMVQAGDFSAGNGT 90
            ||.|:.||.:||.||||||||||||.|||||        ||...|||::.:||.|.|||:..|||
 Frog     1 MGLIIMELRSDVVPKTAENFRALCTHEKGFG--------YKNSGFHRIIPEFMCQGGDFTNHNGT 57

  Fly    91 GGESIYGGTFEDESFEKKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQEL 155
            ||:||||..|.||:|:.:|..|.:|||||.|.|||||||||.|.....||..|||||.||.|.::
 Frog    58 GGKSIYGNKFADENFQLRHTGPGILSMANAGANTNGSQFFICTAKTSWLDGKHVVFGTVIDGMDV 122

  Fly   156 VRQLEGL 162
            |:..|.|
 Frog   123 VKNTEKL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 79/137 (58%)
SH3-RhoG_link 635..>718 CDD:293215
LOC100488106XP_004912407.1 cyclophilin 2..134 CDD:294131 78/136 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.