DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12516 and MSC7

DIOPT Version :10

Sequence 1:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_011904.1 Gene:MSC7 / 856434 SGDID:S000001081 Length:644 Species:Saccharomyces cerevisiae


Alignment Length:64 Identity:16/64 - (25%)
Similarity:26/64 - (40%) Gaps:17/64 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 PFEATQIYRK-EYPLPIASVSIWNERVSSVYDVIGMMNLLDTFKINCFT-VDMEPIKRAFELRK 267
            ||.:|||.:. :||:. .:...|              |.:.:|.:..:| ...:.||..|.|.|
Yeast   593 PFVSTQIPKPLDYPIR-NNAKAW--------------NFVKSFIVGAYTNSTWQRIKSLFSLAK 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 16/64 (25%)
MSC7NP_011904.1 ALDH_F15-22 115..590 CDD:143416
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.