DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12516 and ALDH2B7

DIOPT Version :10

Sequence 1:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_564204.1 Gene:ALDH2B7 / 838991 AraportID:AT1G23800 Length:534 Species:Arabidopsis thaliana


Alignment Length:83 Identity:19/83 - (22%)
Similarity:34/83 - (40%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 WNAPCMMVIFEDGDV----NCALHHLVESLQDPFALDAVAVILVQEALAEEIENRVKILMKPLDA 143
            ||.|.:|:.::.|..    |..:....|  |.|.:...|..:|.:..|.:.:.|.|........|
plant   201 WNFPLLMLSWKLGPALACGNTVVLKTAE--QTPLSALLVGKLLHEAGLPDGVVNIVSGFGATAGA 263

  Fly   144 RVANHPCYKRTLMKIDEL 161
            .:|:|       |.:|::
plant   264 AIASH-------MDVDKV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 19/83 (23%)
ALDH2B7NP_564204.1 PLN02466 1..534 CDD:215259 19/83 (23%)

Return to query results.
Submit another query.