DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12516 and Aldh

DIOPT Version :10

Sequence 1:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_609285.1 Gene:Aldh / 34256 FlyBaseID:FBgn0012036 Length:520 Species:Drosophila melanogaster


Alignment Length:120 Identity:26/120 - (21%)
Similarity:44/120 - (36%) Gaps:37/120 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 WNAPCMMVIFEDGDVNCALHHLVESLQDPFALDAVAVI-LVQEA-LAEEIENRVKILMKP----L 141
            ||.|.:|:.::.|......:.:|....:..:|.|:.:. ||:|| ..|.:.|.|     |    .
  Fly   188 WNFPILMMAWKLGPALATGNTIVLKPAEQTSLTALYIAQLVKEAGFPEGVVNVV-----PGFGTA 247

  Fly   142 DARVANHPC-------------------------YKRTLMKIDELRPKTIIGPSD 171
            .|.:||| |                         .||..:::....|..|:..:|
  Fly   248 GAALANH-CDVDKVAFTGSTDVGKLIQLASGNTNLKRVTLELGGKSPNIILSDTD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 26/120 (22%)
AldhNP_609285.1 ALDH_F1AB_F2_RALDH1 34..514 CDD:143459 26/120 (22%)

Return to query results.
Submit another query.