DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12516 and Aldh1l2

DIOPT Version :10

Sequence 1:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001178707.2 Gene:Aldh1l2 / 299699 RGDID:1309458 Length:923 Species:Rattus norvegicus


Alignment Length:227 Identity:47/227 - (20%)
Similarity:71/227 - (31%) Gaps:88/227 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KSEAVSESEKEVIEV---------SEEPKEEEVKYAWNAPCMMVIFEDGDVNCALHHLVESLQDP 111
            ||.|||..:|..:|:         |:...::.|:....|    |.|..|: ||.           
  Rat   681 KSCAVSNLKKVSLELGGKSPLIIFSDCELDKAVRMGMGA----VFFNKGE-NCI----------- 729

  Fly   112 FALDAVAVILVQEALAEEIENRVKILMK------PLDARV----ANHPCYKRTLMKIDE------ 160
                |...:.|:||:.:|...||...:|      |||...    .||..:...|::..|      
  Rat   730 ----AAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCETGVKEG 790

  Fly   161 ----------------LRPKTIIGPSDRVL----PDATPIMVRDIPHKFLG---DG--------- 193
                            :.|....|..|.:.    ....||||..   ||..   ||         
  Rat   791 ATLVYGGRQVQRPGFFMEPTVFTGVEDHMYLAKEESFGPIMVIS---KFQNGDIDGVLQRANNTE 852

  Fly   194 ---PTGIITMHIFRTPF-----EATQIYRKEY 217
               .:|:.|..|.:..:     ||..::...|
  Rat   853 YGLASGVFTRDISKAMYVSDRLEAGTVFINTY 884

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 38/192 (20%)
Aldh1l2NP_001178707.2 FMT_core_FDH_N 23..225 CDD:187716
FDH_Hydrolase_C 228..327 CDD:187731
PP-binding 346..>390 CDD:425746
ALDH_F1L_FTFDH 438..923 CDD:143458 47/227 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.