DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12516 and ALDH1A3

DIOPT Version :10

Sequence 1:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_000684.2 Gene:ALDH1A3 / 220 HGNCID:409 Length:512 Species:Homo sapiens


Alignment Length:110 Identity:28/110 - (25%)
Similarity:40/110 - (36%) Gaps:26/110 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 VDKSIVVE--GKHEEKQ--------DEHGY-----ISRHFVRRYVLPNGHNESDIVSSLSSDGIL 158
            ||..|.:|  |..|:.:        ||.|:     :...|.|.....|.|...|:......:|::
Human   363 VDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDFFRVQYSENNHLHVDLWPFYPRNGVM 427

  Fly   159 TITC---PRKELEQKKPERAIPITHTGQPAKKLAAAGDAEPAKKN 200
            |...   .|:::|  .||      |..||...|..||....|..|
Human   428 TKDTWLDHRQDVE--FPE------HFLQPLVPLPFAGFMAQAPNN 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 28/110 (25%)
ALDH1A3NP_000684.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
ALDH_F1AB_F2_RALDH1 26..506 CDD:143459 28/110 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.