DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12516 and ALDH1A1

DIOPT Version :10

Sequence 1:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_000680.2 Gene:ALDH1A1 / 216 HGNCID:402 Length:501 Species:Homo sapiens


Alignment Length:45 Identity:9/45 - (20%)
Similarity:15/45 - (33%) Gaps:6/45 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FGGGVTADDLLNAMASVGD------RRLQPRHHHHHLNHRYSRPW 68
            |.|....|.|:..:..:|.      |.:.|.:.........:.||
Human   320 FPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12516NP_651615.2 DUF1487 82..298 CDD:254173
ALDH1A1NP_000680.2 ALDH_F1AB_F2_RALDH1 15..495 CDD:143459 9/45 (20%)
Mediates interaction with PRMT3. /evidence=ECO:0000269|PubMed:33495566 336..501 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.