DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12516 and Aldh1a2

DIOPT Version :10

Sequence 1:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_033048.2 Gene:Aldh1a2 / 19378 MGIID:107928 Length:518 Species:Mus musculus


Alignment Length:84 Identity:22/84 - (26%)
Similarity:36/84 - (42%) Gaps:15/84 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VIFEDGDVNCALHHLVESLQDPF-----ALDAVAVILVQEALAEEIENRV------KILMKPLDA 143
            :||.|.|::.|:.   ::.|..|     ...|.:.|.|:|::.||...|.      :|:..|.|.
Mouse   294 IIFADADLDYAVE---QAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDP 355

  Fly   144 RVANHP-CYKRTLMKIDEL 161
            .....| ..|:...|:.||
Mouse   356 TTEQGPQIDKKQYNKVLEL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 22/84 (26%)
Aldh1a2NP_033048.2 ALDH_F1AB_F2_RALDH1 32..512 CDD:143459 22/84 (26%)

Return to query results.
Submit another query.